1.67 Rating by ClearWebStats

recyclelectro.com has registered 2 years 7 months ago. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, recyclelectro.com is SAFE to browse.

Get Custom Widget

Traffic Report for recyclelectro.com

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
DMOZ Listing: No
Google Pagerank
PR 0 out of 10
PageSpeed Score
Siteadvisor Rating
Not Applicable

Where is recyclelectro.com server located?

Hosted IP Address:

Hosted Country:

United States US

Location Latitude:


Location Longitude:

recyclelectro.com search engine traffic

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 8 H2 Headings: 16
H3 Headings: 4 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 22
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e.

Future Stars - Summer Sports and Specialty Camps in New York

- fscamps.com

Kids love Future Stars sports camps. Join us for a summer of sports and fun in Westchester or Long Island. Soccer, Tennis, Baseball, basketball and more.

  3,339,322   $ 240.00

Pocket Keto – a pocket guide to ketogenic living

- pocketketo.com

  Not Applicable   $ 8.95

My blog – Just another WordPress site

- utterfrugal.com

  Not Applicable   $ 8.95

NHS Scotland scorecard

- nhsscotland-scorecard.org

  Not Applicable   $ 8.95


- kadirilakshminarasimhaswamytemple.com

  Not Applicable   $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 25 Mar 2015 14:49:24 GMT
Server: Apache/2.4.12 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4 mod_fcgid/2.3.10-dev
Last-Modified: Wed, 04 Mar 2015 06:50:16 GMT
ETag: "bb00106-5bab-51070dd259367"
Accept-Ranges: bytes
Content-Length: 23467
Content-Type: text/html

Domain Information for recyclelectro.com

Domain Registrar: GODADDY.COM, LLC
Registration Date: 2015-03-02 2 years 7 months 3 weeks ago
Last Modified: 2015-03-02 2 years 7 months 3 weeks ago
Expiration Date: 2016-03-02 1 year 7 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns39.domaincontrol.com United States United States
ns40.domaincontrol.com United States United States

DNS Record Analysis

Host Type TTL Extra
recyclelectro.com A 599 IP:
recyclelectro.com NS 3599 Target: ns40.domaincontrol.com
recyclelectro.com NS 3599 Target: ns39.domaincontrol.com
recyclelectro.com SOA 3599 MNAME: ns39.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2015030102
Refresh: 28800
Retry: 7200
Expire: 604800
recyclelectro.com MX 3599 Target: mail.recyclelectro.com
recyclelectro.com TXT 3599 TXT: v=spf1 a mx ptr include:secureserver.net

Similarly Ranked Websites to recyclelectro.com


- google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

  1   $ 8,833,062,960.00

Google Calendar

- calendar.google.com

With Google's free online calendar, it’s easy to keep track of life’s important events all in one place.

  1   $ 8,833,062,960.00


- mail.google.com

Gmail is email that's intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

  1   $ 8,833,062,960.00

Google Play

- play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

  1   $ 8,833,062,960.00

Chrome Web Browser

- chrome.google.com

A fast, secure, and free web browser built for the modern web. Chrome syncs bookmarks across all your devices, fills out forms automatically, and so much more.

  1   $ 8,833,062,960.00

Competitive search data from SEMrush

recyclelectro.com search engine traffic graph

Alexa Traffic Rank

Alexa Search Engine Traffic

Like recyclelectro.com ? Comment / rate / feedback below